Lineage for d4c5ja1 (4c5j A:2-276)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904617Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2904618Protein automated matches [190117] (50 species)
    not a true protein
  7. 2904882Species Staphylococcus aureus [TaxId:158878] [237768] (4 PDB entries)
  8. 2904891Domain d4c5ja1: 4c5j A:2-276 [237771]
    Other proteins in same PDB: d4c5ja2, d4c5jb2, d4c5jc2, d4c5jd2
    automated match to d1jxha_
    complexed with so4

Details for d4c5ja1

PDB Entry: 4c5j (more details), 1.45 Å

PDB Description: Structure of the pyridoxal kinase from Staphylococcus aureus
PDB Compounds: (A:) phosphomethylpyrimidine kinase

SCOPe Domain Sequences for d4c5ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c5ja1 c.72.1.0 (A:2-276) automated matches {Staphylococcus aureus [TaxId: 158878]}
alkkvltiagsdtsagagmqadlktfqeldtygmvaltaivtmdkdtwshdvtplpmdvf
ekqletalsigpdaiktgmlgteeiikragevyeasnaqyfvvdpvmvckgedevlnpgn
teamikyllpkatvvtpnlfeagqlsglgklnsiedmkkaatiifdkgaqhviikggkal
dqdksydlyydgqtfyqlttdmfqqsynhgagctfaaattaylangkspkeavisakafv
asaikngwkmndfvgpvdhgaynriehidvevtev

SCOPe Domain Coordinates for d4c5ja1:

Click to download the PDB-style file with coordinates for d4c5ja1.
(The format of our PDB-style files is described here.)

Timeline for d4c5ja1: