SCOPe 2.08: Domain d4bmea_: 4bme A:

Lineage for d4bmea_ (4bme A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries)

8. Domain d4bmea_: 4bme A: [237763]
   automated match to d1a3ka_
   mutant

Details for d4bmea_

PDB Entry: 4bme, 2 Å

PDB Description: crystal structure of the n terminal domain of human galectin 8, f19y mutant

PDB Compounds: (A:) Galectin-8

SCOPe Domain Sequences for d4bmea_:

Sequence, based on SEQRES records:

>d4bmea_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlqniiynpvipyvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradvafhf
nprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtlly
ghrigpekidtlgiygkvnihsigfsfss

Sequence, based on observed residues (ATOM records):

>d4bmea_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlqniiynpvipyvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradvafhf
nprfkgcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtllygh
rigpekidtlgiygkvnihsigfsfss

Timeline for d4bmea_:

• d4bmea_ first appeared in SCOPe 2.03
  
• d4bmea_ appears in SCOPe 2.07