Lineage for d4bmnd_ (4bmn D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848266Species Ralstonia sp. [TaxId:517192] [197315] (6 PDB entries)
  8. 2848270Domain d4bmnd_: 4bmn D: [237759]
    Other proteins in same PDB: d4bmna2, d4bmnb2, d4bmnc2
    automated match to d3enna_
    complexed with edo, tam

Details for d4bmnd_

PDB Entry: 4bmn (more details), 1.5 Å

PDB Description: apo structure of short-chain alcohol dehydrogenase from Ralstonia sp. DSM 6428
PDB Compounds: (D:) Alclohol dehydrogenase/short-chain dehydrogenase

SCOPe Domain Sequences for d4bmnd_:

Sequence, based on SEQRES records: (download)

>d4bmnd_ c.2.1.0 (D:) automated matches {Ralstonia sp. [TaxId: 517192]}
myrllnktavitggnsgiglatakrfvaegayvfivgrrrkeleqaaaeigrnvtavkad
vtkledldrlyaivreqrgsidvlfansgaieqktleeitpehydrtfdvnvrgliftvq
kalpllrdggsviltssvagvlglqahdtysaakaavrslartwttelkgrsirvnavsp
gaidtpiienqvstqeeadelrakfaaatplgrvgrpeelaaavlflasddssyvagiel
fvdggltqv

Sequence, based on observed residues (ATOM records): (download)

>d4bmnd_ c.2.1.0 (D:) automated matches {Ralstonia sp. [TaxId: 517192]}
myrllnktavitggnsgiglatakrfvaegayvfivgrrrkeleqaaaeigrnvtavkad
vtkledldrlyaivreqrgsidvlfansgaieqktleeitpehydrtfdvnvrgliftvq
kalpllrdggsviltssvagvlglqahdtysaakaavrslartwttelkgrsirvnavsp
gaidfaaatplgrvgrpeelaaavlflasddssyvagielfvdggltqv

SCOPe Domain Coordinates for d4bmnd_:

Click to download the PDB-style file with coordinates for d4bmnd_.
(The format of our PDB-style files is described here.)

Timeline for d4bmnd_: