Lineage for d4bmnb1 (4bmn B:1-249)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095774Species Ralstonia sp. [TaxId:517192] [197315] (6 PDB entries)
  8. 2095776Domain d4bmnb1: 4bmn B:1-249 [237758]
    Other proteins in same PDB: d4bmna2, d4bmnb2, d4bmnc2
    automated match to d3enna_
    complexed with edo, tam

Details for d4bmnb1

PDB Entry: 4bmn (more details), 1.5 Å

PDB Description: apo structure of short-chain alcohol dehydrogenase from Ralstonia sp. DSM 6428
PDB Compounds: (B:) Alclohol dehydrogenase/short-chain dehydrogenase

SCOPe Domain Sequences for d4bmnb1:

Sequence, based on SEQRES records: (download)

>d4bmnb1 c.2.1.0 (B:1-249) automated matches {Ralstonia sp. [TaxId: 517192]}
myrllnktavitggnsgiglatakrfvaegayvfivgrrrkeleqaaaeigrnvtavkad
vtkledldrlyaivreqrgsidvlfansgaieqktleeitpehydrtfdvnvrgliftvq
kalpllrdggsviltssvagvlglqahdtysaakaavrslartwttelkgrsirvnavsp
gaidtpiienqvstqeeadelrakfaaatplgrvgrpeelaaavlflasddssyvagiel
fvdggltqv

Sequence, based on observed residues (ATOM records): (download)

>d4bmnb1 c.2.1.0 (B:1-249) automated matches {Ralstonia sp. [TaxId: 517192]}
myrllnktavitggnsgiglatakrfvaegayvfivgrrrkeleqaaaeigrnvtavkad
vtkledldrlyaivreqrgsidvlfansgaieqktleeitpehydrtfdvnvrgliftvq
kalpllrdggsviltssvagvlglqahdtysaakaavrslartwttelkgrsirvnavsp
gaidaatplgrvgrpeelaaavlflasddssyvagielfvdggltqv

SCOPe Domain Coordinates for d4bmnb1:

Click to download the PDB-style file with coordinates for d4bmnb1.
(The format of our PDB-style files is described here.)

Timeline for d4bmnb1: