SCOPe 2.08: Domain d3ilya1: 3ily A:1-157

Lineage for d3ilya1 (3ily A:1-157)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.0: automated matches [191415] (1 protein)
   not a true family

6. Protein automated matches [190574] (20 species)
   not a true protein

7. Species Entamoeba histolytica [TaxId:294381] [196531] (4 PDB entries)

8. Domain d3ilya1: 3ily A:1-157 [237756]
   Other proteins in same PDB: d3ilya2, d3ilyb2
   automated match to d3idoa_

Details for d3ilya1

PDB Entry: 3ily, 2.2 Å

PDB Description: apo crystal structure of protein tyrosine phosphatase from entamoeba histolytica featuring a disordered active site

PDB Compounds: (A:) Protein tyrosine phosphatase, putative

SCOPe Domain Sequences for d3ilya1:

Sequence, based on SEQRES records:

>d3ilya1 c.44.1.0 (A:1-157) automated matches {Entamoeba histolytica [TaxId: 294381]}
mkllfvclgnicrspaaeavmkkviqnhhltekyicdsagtcsyhegqqadsrmrkvgks
rgyqvdsisrpvvssdfknfdyifamdndnyyelldrcpeqykqkifkmvdfcttiktte
vpdpyyggekgfhrvidiledacenliikleegklin

Sequence, based on observed residues (ATOM records):

>d3ilya1 c.44.1.0 (A:1-157) automated matches {Entamoeba histolytica [TaxId: 294381]}
mkllfvrspaaeavmkkviqnhhltekyicdsagqadsrmrkvgksrgyqvdsisrpvvs
sdfknfdyifamdndnyyelldrcpeqykqkifkmvdfcttikttevpdpygekgfhrvi
diledacenliikleegklin

Timeline for d3ilya1:

• d3ilya1 first appeared in SCOPe 2.03, called d3ilya_
  
• d3ilya1 appears in SCOPe 2.07