Lineage for d3ilya1 (3ily A:1-157)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2874828Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2874901Family c.44.1.0: automated matches [191415] (1 protein)
    not a true family
  6. 2874902Protein automated matches [190574] (20 species)
    not a true protein
  7. 2874917Species Entamoeba histolytica [TaxId:294381] [196531] (4 PDB entries)
  8. 2874922Domain d3ilya1: 3ily A:1-157 [237756]
    Other proteins in same PDB: d3ilya2, d3ilyb2
    automated match to d3idoa_

Details for d3ilya1

PDB Entry: 3ily (more details), 2.2 Å

PDB Description: apo crystal structure of protein tyrosine phosphatase from entamoeba histolytica featuring a disordered active site
PDB Compounds: (A:) Protein tyrosine phosphatase, putative

SCOPe Domain Sequences for d3ilya1:

Sequence, based on SEQRES records: (download)

>d3ilya1 c.44.1.0 (A:1-157) automated matches {Entamoeba histolytica [TaxId: 294381]}
mkllfvclgnicrspaaeavmkkviqnhhltekyicdsagtcsyhegqqadsrmrkvgks
rgyqvdsisrpvvssdfknfdyifamdndnyyelldrcpeqykqkifkmvdfcttiktte
vpdpyyggekgfhrvidiledacenliikleegklin

Sequence, based on observed residues (ATOM records): (download)

>d3ilya1 c.44.1.0 (A:1-157) automated matches {Entamoeba histolytica [TaxId: 294381]}
mkllfvrspaaeavmkkviqnhhltekyicdsagqadsrmrkvgksrgyqvdsisrpvvs
sdfknfdyifamdndnyyelldrcpeqykqkifkmvdfcttikttevpdpygekgfhrvi
diledacenliikleegklin

SCOPe Domain Coordinates for d3ilya1:

Click to download the PDB-style file with coordinates for d3ilya1.
(The format of our PDB-style files is described here.)

Timeline for d3ilya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ilya2