Lineage for d3zmka2 (3zmk A:87-221)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1999700Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1999701Protein automated matches [226831] (61 species)
    not a true protein
  7. 1999728Species Anopheles funestus [TaxId:62324] [236281] (2 PDB entries)
  8. 1999731Domain d3zmka2: 3zmk A:87-221 [237749]
    Other proteins in same PDB: d3zmka1, d3zmkb1, d3zmkb3, d3zmkc1, d3zmkd1
    automated match to d3zmkd2
    complexed with gsh

Details for d3zmka2

PDB Entry: 3zmk (more details), 2.01 Å

PDB Description: Anopheles funestus glutathione-s-transferase epsilon 2 (GSTe2) protein structure from different alelles: A single amino acid change confers high level of DDT resistance and cross resistance to permethrin in a major malaria vector in Africa
PDB Compounds: (A:) glutathione s-transferase e2

SCOPe Domain Sequences for d3zmka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zmka2 a.45.1.0 (A:87-221) automated matches {Anopheles funestus [TaxId: 62324]}
pkdpvqqarvnaalhfesgvlfarmrfiferiffygksdipedrveyvqksyrlledtlk
ddfvagskmtiadfscistissimgvvpleqsehpriyewidrlkqlpyyeeanggggtd
lgkfvlakkeenaka

SCOPe Domain Coordinates for d3zmka2:

Click to download the PDB-style file with coordinates for d3zmka2.
(The format of our PDB-style files is described here.)

Timeline for d3zmka2: