Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Anopheles funestus [TaxId:62324] [236279] (2 PDB entries) |
Domain d3zmka1: 3zmk A:3-86 [237748] Other proteins in same PDB: d3zmka2, d3zmkb2, d3zmkc2, d3zmkd2 automated match to d3zmkd1 complexed with gsh |
PDB Entry: 3zmk (more details), 2.01 Å
SCOPe Domain Sequences for d3zmka1:
Sequence, based on SEQRES records: (download)
>d3zmka1 c.47.1.0 (A:3-86) automated matches {Anopheles funestus [TaxId: 62324]} klvlytlhlsppcraveltakalgleleqkninllagdhltpefmklnpqhtipvldddg tiiteshaimiylvtkygkddtly
>d3zmka1 c.47.1.0 (A:3-86) automated matches {Anopheles funestus [TaxId: 62324]} klvlytlhlsppcraveltakalgleleqknitipvldddgtiiteshaimiylvtkygk ddtly
Timeline for d3zmka1: