Lineage for d3wnua2 (3wnu A:430-720)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328973Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2328974Protein automated matches [191104] (13 species)
    not a true protein
  7. 2329081Species Synechococcus elongatus [TaxId:1140] [237745] (3 PDB entries)
  8. 2329085Domain d3wnua2: 3wnu A:430-720 [237747]
    automated match to d3n3qb2
    complexed with heb, na

Details for d3wnua2

PDB Entry: 3wnu (more details), 2.2 Å

PDB Description: The crystal structure of catalase-peroxidase, KatG, from Synechococcus PCC7942
PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d3wnua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wnua2 a.93.1.0 (A:430-720) automated matches {Synechococcus elongatus [TaxId: 1140]}
liwqdpipagnrnydvqavkdriaasglsiselvstawdsartyrnsdkrggangarirl
apqkdwegnepdrlakvlavlegiaaatgasvadvivlagnvgveqaaraagveivlpfa
pgrgdataeqtdtesfavlepihdgyrnwlkqdyaatpeellldrtqllgltapemtvli
gglrvlgtnhggtkhgvftdregvltndffvnltdmnylwkpagknlyeicdrktnqvkw
tatrvdlvfgsnsilrayselyaqddnkekfvrdfvaawtkvmnadrfdld

SCOPe Domain Coordinates for d3wnua2:

Click to download the PDB-style file with coordinates for d3wnua2.
(The format of our PDB-style files is described here.)

Timeline for d3wnua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wnua1