Lineage for d3wnua1 (3wnu A:11-429)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2003088Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2003089Protein automated matches [191104] (11 species)
    not a true protein
  7. 2003179Species Synechococcus elongatus [TaxId:1140] [237745] (3 PDB entries)
  8. 2003182Domain d3wnua1: 3wnu A:11-429 [237746]
    automated match to d3n3pb1
    complexed with heb, na

Details for d3wnua1

PDB Entry: 3wnu (more details), 2.2 Å

PDB Description: The crystal structure of catalase-peroxidase, KatG, from Synechococcus PCC7942
PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d3wnua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wnua1 a.93.1.0 (A:11-429) automated matches {Synechococcus elongatus [TaxId: 1140]}
mhggattvnistaewwpkalnldilsqhdrktnpmgpdfnyqeevkkldvaalkqdlqal
mtdsqdwwpadwghygglmirltwhaagtyriadgrggagtgnqrfaplnswpdntnldk
arrllwpikqkygnklswadliayagtiayesmglktfgfafgrediwhpekdiywgpek
ewvppstnpnsrytgdrelenplaavtmgliyvnpegvdgnpdplktahdvrvtfarmam
ndeetvaltagghtvgkchgngnaallgpepegadvedqglgwinktqsgigrnavtsgl
egawtphptqwdngyfrmllnydwelkkspagawqwepinpreedlpvdvedpsirrnlv
mtdadmamkmdpeyrkiserfyqdpayfadvfarawfklthrdmgpkaryigpdvpqed

SCOPe Domain Coordinates for d3wnua1:

Click to download the PDB-style file with coordinates for d3wnua1.
(The format of our PDB-style files is described here.)

Timeline for d3wnua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wnua2