SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3w86a_ (3w86 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080046Protein Dihydroorotate dehydrogenase [51397] (8 species)
  7. 2080113Species Trypanosoma cruzi [TaxId:353153] [254868] (49 PDB entries)
  8. 2080130Domain d3w86a_: 3w86 A: [237736]
    automated match to d3w1aa_
    complexed with cac, edo, fmn, gol, nco, w86

Details for d3w86a_

PDB Entry: 3w86 (more details), 1.5 Å

PDB Description: Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with SH-1-96
PDB Compounds: (A:) Dihydroorotate dehydrogenase (fumarate)

SCOPe Domain Sequences for d3w86a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w86a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Trypanosoma cruzi [TaxId: 353153]}
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie

SCOPe Domain Coordinates for d3w86a_:

Click to download the PDB-style file with coordinates for d3w86a_.
(The format of our PDB-style files is described here.)

Timeline for d3w86a_: