Lineage for d3w86b_ (3w86 B:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) 
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) 
Protein Dihydroorotate dehydrogenase [51397] (8 species) 
Species Trypanosoma cruzi [TaxId:353153] [254868] (49 PDB entries) 
Domain d3w86b_: 3w86 B: [237732]
automated match to d3w1aa_
complexed with cac, edo, fmn, gol, nco, w86
Details for d3w86b_
PDB Entry: 3w86 (more details), 1.5 Å
PDB Description: structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with sh-1-96
PDB Compounds: (B:) Dihydroorotate dehydrogenase (fumarate)SCOPe Domain Sequences for d3w86b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w86b_ c.1.4.1 (B:) Dihydroorotate dehydrogenase {Trypanosoma cruzi [TaxId: 353153]}
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie
SCOPe Domain Coordinates for d3w86b_:
Click to download the PDB-style file with coordinates for d3w86b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3w86b_:
- d3w86b_ first appeared in SCOPe 2.03
- d3w86b_ appears in SCOPe 2.06
- d3w86b_ appears in the current release, SCOPe 2.08
View in 3D
