SCOPe 2.08: Domain d4oufb_: 4ouf B:

Lineage for d4oufb_ (4ouf B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (6 proteins)

6. Protein CREB-binding protein, CBP [74712] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74713] (59 PDB entries)

8. Domain d4oufb_: 4ouf B: [237723]
   automated match to d2d82a1
   complexed with edo, peg

Details for d4oufb_

PDB Entry: 4ouf, 1.4 Å

PDB Description: Crystal Structure of CBP bromodomain

PDB Compounds: (B:) creb-binding protein

SCOPe Domain Sequences for d4oufb_:

Sequence; same for both SEQRES and ATOM records:

>d4oufb_ a.29.2.1 (B:) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkld
tgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqs

Timeline for d4oufb_:

• d4oufb_ first appeared in SCOPe 2.03
  
• d4oufb_ appears in SCOPe 2.07