Lineage for d1dyob_ (1dyo B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) Superfamily b.18.1: Galactose-binding domain-like [49785] (8 families) 
Family b.18.1.7: Xylan-binding domain [49811] (1 protein) Protein Xylan-binding domain [49812] (1 species) Species Clostridium thermocellum [TaxId:1515] [49813] (1 PDB entry) 
Domain d1dyob_: 1dyo B: [23772]
Details for d1dyob_
PDB Entry: 1dyo (more details), 2.1 Å
PDB Description: xylan-binding domain from cbm 22, formally x6b domain
SCOP Domain Sequences for d1dyob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dyob_ b.18.1.7 (B:) Xylan-binding domain {Clostridium thermocellum}
pdagyyyhdtfegsvgqwtargpaevllsgrtaykgsesllvrnrtaawngaqralnprt
fvpgntycfsvvasfiegassttfcmklqyvdgsgtqrydtidmktvgpnqwvhlynpqy
ripsdatdmyvyvetaddtinfyideaigavagtvi
SCOP Domain Coordinates for d1dyob_:
Click to download the PDB-style file with coordinates for d1dyob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dyob_:
- d1dyob_ appears in SCOP 1.57
- d1dyob_ appears in the current release, SCOPe 2.08
View in 3D
