![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.7: CBM22 [49811] (1 protein) CBM family 22, formerly x6b domain automatically mapped to Pfam PF02018 |
![]() | Protein Xylan-binding domain [49812] (1 species) |
![]() | Species Clostridium thermocellum [TaxId:1515] [49813] (3 PDB entries) |
![]() | Domain d1dyob_: 1dyo B: [23772] complexed with ca |
PDB Entry: 1dyo (more details), 2.1 Å
SCOPe Domain Sequences for d1dyob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dyob_ b.18.1.7 (B:) Xylan-binding domain {Clostridium thermocellum [TaxId: 1515]} pdagyyyhdtfegsvgqwtargpaevllsgrtaykgsesllvrnrtaawngaqralnprt fvpgntycfsvvasfiegassttfcmklqyvdgsgtqrydtidmktvgpnqwvhlynpqy ripsdatdmyvyvetaddtinfyideaigavagtvi
Timeline for d1dyob_: