Lineage for d1dyob_ (1dyo B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774485Family b.18.1.7: CBM22 [49811] (1 protein)
    CBM family 22, formerly x6b domain
    automatically mapped to Pfam PF02018
  6. 2774486Protein Xylan-binding domain [49812] (1 species)
  7. 2774487Species Clostridium thermocellum [TaxId:1515] [49813] (3 PDB entries)
  8. 2774492Domain d1dyob_: 1dyo B: [23772]
    complexed with ca

Details for d1dyob_

PDB Entry: 1dyo (more details), 2.1 Å

PDB Description: xylan-binding domain from cbm 22, formally x6b domain
PDB Compounds: (B:) endo-1,4-beta-xylanase y

SCOPe Domain Sequences for d1dyob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dyob_ b.18.1.7 (B:) Xylan-binding domain {Clostridium thermocellum [TaxId: 1515]}
pdagyyyhdtfegsvgqwtargpaevllsgrtaykgsesllvrnrtaawngaqralnprt
fvpgntycfsvvasfiegassttfcmklqyvdgsgtqrydtidmktvgpnqwvhlynpqy
ripsdatdmyvyvetaddtinfyideaigavagtvi

SCOPe Domain Coordinates for d1dyob_:

Click to download the PDB-style file with coordinates for d1dyob_.
(The format of our PDB-style files is described here.)

Timeline for d1dyob_: