SCOPe 2.04: Domain d4oqob_: 4oqo B:

Lineage for d4oqob_ (4oqo B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Lactoferrin [53889] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53891] (8 PDB entries)

8. Domain d4oqob_: 4oqo B: [237717]
   automated match to d2q8ja_
   complexed with nag

Details for d4oqob_

PDB Entry: 4oqo, 2.42 Å

PDB Description: crystal structure of the tryptic generated iron-free c-lobe of bovine lactoferrin at 2.42 angstrom resolution

PDB Compounds: (B:) lactotransferrin

SCOPe Domain Sequences for d4oqob_:

Sequence; same for both SEQRES and ATOM records:

>d4oqob_ c.94.1.2 (B:) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcstsplleacafltr

Timeline for d4oqob_:

• d4oqob_ first appeared in SCOPe 2.03
  
• d4oqob_ appears in SCOPe 2.05
  
• d4oqob_ appears in the current release, SCOPe 2.08