SCOPe 2.05: Domain d4olqc_: 4olq C:

Lineage for d4olqc_ (4olq C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (49 species)
   not a true protein

7. Species Hyphomonas neptunium [TaxId:228405] [237710] (2 PDB entries)

8. Domain d4olqc_: 4olq C: [237713]
   automated match to d2ej5a_
   complexed with mlt, p6g, peg, pg4, unl

Details for d4olqc_

PDB Entry: 4olq, 2.7 Å

PDB Description: crystal structure of a putative enoyl-coa hydratase/isomerase family protein from hyphomonas neptunium

PDB Compounds: (C:) Enoyl-CoA hydratase/isomerase family protein

SCOPe Domain Sequences for d4olqc_:

Sequence; same for both SEQRES and ATOM records:

>d4olqc_ c.14.1.0 (C:) automated matches {Hyphomonas neptunium [TaxId: 228405]}
lpirldiaaplaeivlnkperrnalsvdmwaaipglvaeananpdvklilihggdagafa
agadisefetiyatedaakasgqriaqaldaiensekpviaaiegacvgggvslamaadl
rvagegakfgvtpgklglvypagdtrrllaavgpgatkdilftgriftageakslglidr
lvekgtaleaarvwageiaaisqwsvratkrmirglqtgwtdetpeaqslflngfanedf
kegyrafldkrpakftyr

Timeline for d4olqc_:

• d4olqc_ first appeared in SCOPe 2.03
  
• d4olqc_ appears in SCOPe 2.04
  
• d4olqc_ appears in SCOPe 2.06
  
• d4olqc_ appears in the current release, SCOPe 2.08