Lineage for d4ocaa_ (4oca A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131998Protein automated matches [190152] (22 species)
    not a true protein
  7. 2132052Species Salmonella enterica [TaxId:90371] [237706] (1 PDB entry)
  8. 2132053Domain d4ocaa_: 4oca A: [237707]
    automated match to d1mdoa_
    complexed with 2qr

Details for d4ocaa_

PDB Entry: 4oca (more details), 2.3 Å

PDB Description: Cryatal structure of ArnB K188A complexted with PLP and UDP-Ara4N
PDB Compounds: (A:) UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase

SCOPe Domain Sequences for d4ocaa_:

Sequence, based on SEQRES records: (download)

>d4ocaa_ c.67.1.4 (A:) automated matches {Salmonella enterica [TaxId: 90371]}
sdflpfsrpamgaeelaavktvldsgwittgpknqeleaafcrltgnqyavavssatagm
hialmalgigegdevitpsmtwvstlnmivllganpvmvdvdrdtlmvtpehieaaitpq
tkaiipvhyagapadldaiyalgerygipviedaahatgtsykgrhigargtaifsfhai
anitcaeggivvtdnpqfadklrslkfhglgvdawdrqsggrapqaevlapgykynlpdl
naaialaqlqkldalnarraaiaaqyhqamadlpfqplslpswehihawhlfiirvdear
cgitrdalmaslktkgigtglhfraahtqkyyrerfptltlpdtewnsericslplfpdm
tesdfdrvitalhqiag

Sequence, based on observed residues (ATOM records): (download)

>d4ocaa_ c.67.1.4 (A:) automated matches {Salmonella enterica [TaxId: 90371]}
sdflpfsrpamgaeelaavktvldsgwittgpknqeleaafcrltgnqyavavssatagm
hialmalgigegdevitpsmtwvstlnmivllganpvmvdvdrdtlmvtpehieaaitpq
tkaiipvhyagapadldaiyalgerygipviedaahatgtsykgrhigargtaifsfhai
anitcaeggivvtdnpqfadklrslkfhglgaevlapgykynlpdlnaaialaqlqklda
lnarraaiaaqyhqamadlpfqplslpswehihawhlfiirvdearcgitrdalmaslkt
kgigtglhfraahtqkyyrerfptltlpdtewnsericslplfpdmtesdfdrvitalhq
iag

SCOPe Domain Coordinates for d4ocaa_:

Click to download the PDB-style file with coordinates for d4ocaa_.
(The format of our PDB-style files is described here.)

Timeline for d4ocaa_: