SCOPe 2.03: Domain d4nyiq_: 4nyi Q:

Lineage for d4nyiq_ (4nyi Q:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (100 PDB entries)
   Uniprot Q6P716

8. Domain d4nyiq_: 4nyi Q: [237705]
   Other proteins in same PDB: d4nyis_
   automated match to d1nvvq_
   complexed with 2px, gnp, mg

Details for d4nyiq_

PDB Entry: 4nyi, 2.96 Å

PDB Description: Approach for Targeting Ras with Small Molecules that Activate SOS-Mediated Nucleotide Exchange

PDB Compounds: (Q:) gtpase hras

SCOPe Domain Sequences for d4nyiq_:

Sequence; same for both SEQRES and ATOM records:

>d4nyiq_ c.37.1.8 (Q:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
gmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
gqeeasamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcd
laartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d4nyiq_:

• d4nyiq_ is new in SCOPe 2.03-stable
  
• d4nyiq_ appears in SCOPe 2.04
  
• d4nyiq_ appears in the current release, SCOPe 2.08, called d4nyiq1