Lineage for d4nyiq_ (4nyi Q:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1362957Protein cH-p21 Ras protein [52593] (1 species)
  7. 1362958Species Human (Homo sapiens) [TaxId:9606] [52594] (100 PDB entries)
    Uniprot Q6P716
  8. 1363060Domain d4nyiq_: 4nyi Q: [237705]
    Other proteins in same PDB: d4nyis_
    automated match to d1nvvq_
    complexed with 2px, gnp, mg

Details for d4nyiq_

PDB Entry: 4nyi (more details), 2.96 Å

PDB Description: Approach for Targeting Ras with Small Molecules that Activate SOS-Mediated Nucleotide Exchange
PDB Compounds: (Q:) gtpase hras

SCOPe Domain Sequences for d4nyiq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nyiq_ c.37.1.8 (Q:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
gmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
gqeeasamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcd
laartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOPe Domain Coordinates for d4nyiq_:

Click to download the PDB-style file with coordinates for d4nyiq_.
(The format of our PDB-style files is described here.)

Timeline for d4nyiq_:

  • d4nyiq_ appears in periodic updates to SCOPe 2.03 starting on 2014-03-12
  • d4nyiq_ appears in SCOPe 2.04
  • d4nyiq_ appears in the current release, SCOPe 2.07, called d4nyiq1