Lineage for d4o4ic2 (4o4i C:246-440)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1657767Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1657768Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1657875Protein automated matches [227071] (2 species)
    not a true protein
  7. 1657876Species Cow (Bos taurus) [TaxId:9913] [226565] (14 PDB entries)
  8. 1657925Domain d4o4ic2: 4o4i C:246-440 [237701]
    Other proteins in same PDB: d4o4ia1, d4o4ib1, d4o4ic1, d4o4id1, d4o4ie_
    automated match to d3ryha2
    complexed with acp, ca, ep, gdp, gtp, llm, mes, mg

Details for d4o4ic2

PDB Entry: 4o4i (more details), 2.4 Å

PDB Description: Tubulin-Laulimalide-Epothilone A complex
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4o4ic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o4ic2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d4o4ic2:

Click to download the PDB-style file with coordinates for d4o4ic2.
(The format of our PDB-style files is described here.)

Timeline for d4o4ic2: