| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
| Protein automated matches [227071] (2 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [226565] (14 PDB entries) |
| Domain d4o4ic2: 4o4i C:246-440 [237701] Other proteins in same PDB: d4o4ia1, d4o4ib1, d4o4ic1, d4o4id1, d4o4ie_ automated match to d3ryha2 complexed with acp, ca, ep, gdp, gtp, llm, mes, mg |
PDB Entry: 4o4i (more details), 2.4 Å
SCOPe Domain Sequences for d4o4ic2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o4ic2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv
Timeline for d4o4ic2: