SCOPe 2.07: Domain d1cx1a1: 1cx1 A:3-153

Lineage for d1cx1a1 (1cx1 A:3-153)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.14: CBM4/9 [74893] (4 proteins)

6. Protein Cellulose-binding domain of cellulase C [49809] (1 species)

7. Species Cellulomonas fimi [TaxId:1708] [49810] (4 PDB entries)

8. Domain d1cx1a1: 1cx1 A:3-153 [23770]
   Other proteins in same PDB: d1cx1a2
   second N-terminal CBD

Details for d1cx1a1

PDB Entry: 1cx1

PDB Description: second n-terminal cellulose-binding domain from cellulomonas fimi beta-1,4-glucanase c, nmr, 22 structures

PDB Compounds: (A:) endoglucanase c

SCOPe Domain Sequences for d1cx1a1:

Sequence; same for both SEQRES and ATOM records:

>d1cx1a1 b.18.1.14 (A:3-153) Cellulose-binding domain of cellulase C {Cellulomonas fimi [TaxId: 1708]}
ldsevellphtsfaeslgpwslygtsepvfadgrmcvdlpggqgnpwdaglvyngvpvge
gesyvlsftasatpdmpvrvlvgegggayrtafeqgsapltgepatreyaftsnltfppd
gdapgqvafhlgkagayefcisqvslttsat

Timeline for d1cx1a1:

• d1cx1a1 first appeared (with stable ids) in SCOP 1.55, called d1cx1a_
  
• d1cx1a1 appears in SCOPe 2.06
  
• d1cx1a1 appears in the current release, SCOPe 2.08