Lineage for d1cx1a_ (1cx1 A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12057Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 12058Superfamily b.18.1: Galactose-binding domain-like [49785] (8 families) (S)
  5. 12140Family b.18.1.6: Cellulose-binding domain [49808] (1 protein)
  6. 12141Protein Cellulose-binding domain [49809] (1 species)
  7. 12142Species Cellulomonas fimi [TaxId:1708] [49810] (3 PDB entries)
  8. 12145Domain d1cx1a_: 1cx1 A: [23770]

Details for d1cx1a_

PDB Entry: 1cx1 (more details)

PDB Description: second n-terminal cellulose-binding domain from cellulomonas fimi beta-1,4-glucanase c, nmr, 22 structures

SCOP Domain Sequences for d1cx1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cx1a_ b.18.1.6 (A:) Cellulose-binding domain {Cellulomonas fimi}
asldsevellphtsfaeslgpwslygtsepvfadgrmcvdlpggqgnpwdaglvyngvpv
gegesyvlsftasatpdmpvrvlvgegggayrtafeqgsapltgepatreyaftsnltfp
pdgdapgqvafhlgkagayefcisqvslttsat

SCOP Domain Coordinates for d1cx1a_:

Click to download the PDB-style file with coordinates for d1cx1a_.
(The format of our PDB-style files is described here.)

Timeline for d1cx1a_: