![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.14: CBM4/9 [74893] (4 proteins) |
![]() | Protein Cellulose-binding domain of cellulase C [49809] (1 species) |
![]() | Species Cellulomonas fimi [TaxId:1708] [49810] (4 PDB entries) |
![]() | Domain d1cx1a1: 1cx1 A:3-153 [23770] Other proteins in same PDB: d1cx1a2 second N-terminal CBD |
PDB Entry: 1cx1 (more details)
SCOPe Domain Sequences for d1cx1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cx1a1 b.18.1.14 (A:3-153) Cellulose-binding domain of cellulase C {Cellulomonas fimi [TaxId: 1708]} ldsevellphtsfaeslgpwslygtsepvfadgrmcvdlpggqgnpwdaglvyngvpvge gesyvlsftasatpdmpvrvlvgegggayrtafeqgsapltgepatreyaftsnltfppd gdapgqvafhlgkagayefcisqvslttsat
Timeline for d1cx1a1: