| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.10: Stathmin [101494] (1 family) ![]() single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
| Family a.137.10.1: Stathmin [101495] (2 proteins) |
| Protein Stathmin 4 [101496] (3 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
| Domain d4o4ie_: 4o4i E: [237693] Other proteins in same PDB: d4o4ia1, d4o4ia2, d4o4ib1, d4o4ib2, d4o4ic1, d4o4ic2, d4o4id1, d4o4id2, d4o4if1, d4o4if2 automated match to d4i4te_ complexed with acp, ca, ep, gdp, gtp, llm, mes, mg |
PDB Entry: 4o4i (more details), 2.4 Å
SCOPe Domain Sequences for d4o4ie_:
Sequence, based on SEQRES records: (download)
>d4o4ie_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea
>d4o4ie_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkpdpsleeiqkkleaaeerrkyqeaellkhlaekreherev
iqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelkee
a
Timeline for d4o4ie_: