Lineage for d4nyis_ (4nyi S:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006307Fold a.117: Ras GEF [48365] (1 superfamily)
    multihelical
  4. 2006308Superfamily a.117.1: Ras GEF [48366] (1 family) (S)
  5. 2006309Family a.117.1.1: Ras GEF [48367] (2 protein domains)
  6. 2006310Protein Son of sevenless protein homolog 1 (sos-1) [48368] (1 species)
  7. 2006311Species Human (Homo sapiens) [TaxId:9606] [48369] (11 PDB entries)
    Uniprot Q07889 189-1046
  8. 2006319Domain d4nyis_: 4nyi S: [237692]
    Other proteins in same PDB: d4nyiq1, d4nyiq2, d4nyir1, d4nyir2
    automated match to d1nvus_
    complexed with 2px, gnp, mg

Details for d4nyis_

PDB Entry: 4nyi (more details), 2.96 Å

PDB Description: Approach for Targeting Ras with Small Molecules that Activate SOS-Mediated Nucleotide Exchange
PDB Compounds: (S:) Son of sevenless homolog 1

SCOPe Domain Sequences for d4nyis_:

Sequence, based on SEQRES records: (download)

>d4nyis_ a.117.1.1 (S:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfvr
tflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpv
qlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiard
ngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselv
gsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqel
nnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinpp
cvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrves
dikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnp
r

Sequence, based on observed residues (ATOM records): (download)

>d4nyis_ a.117.1.1 (S:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeenmagipiikagtviklierltyhmyadpnfvrtfl
ttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvqlr
vlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiahnitf
qsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedk
einspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlev
vsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyl
tnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenl
npmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnpr

SCOPe Domain Coordinates for d4nyis_:

Click to download the PDB-style file with coordinates for d4nyis_.
(The format of our PDB-style files is described here.)

Timeline for d4nyis_: