SCOPe 2.06: Domain d4ntyc_: 4nty C:

Lineage for d4ntyc_ (4nty C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.0: automated matches [194891] (1 protein)
   not a true family

6. Protein automated matches [194892] (2 species)
   not a true protein

7. Species Micrurus tener [TaxId:1114302] [237091] (3 PDB entries)

8. Domain d4ntyc_: 4nty C: [237691]
   Other proteins in same PDB: d4ntyb_
   automated match to d4ntxc_
   complexed with cl, cs, pe4

Details for d4ntyc_

PDB Entry: 4nty, 2.65 Å

PDB Description: cesium sites in the crystal structure of acid-sensing ion channel in complex with snake toxin

PDB Compounds: (C:) Basic phospholipase A2 homolog Tx-beta

SCOPe Domain Sequences for d4ntyc_:

Sequence; same for both SEQRES and ATOM records:

>d4ntyc_ a.133.1.0 (C:) automated matches {Micrurus tener [TaxId: 1114302]}
nlnqfrlmikctndrvwadfvdygcycvardsntpvddldrccqaqkqcydeavkvhgck
plvmfysfecrylasdldcsgnntkcrnfvcncdrtatlciltatynrnnhkidpsrc

Timeline for d4ntyc_:

• d4ntyc_ first appeared in SCOPe 2.03
  
• d4ntyc_ appears in SCOPe 2.05
  
• d4ntyc_ appears in SCOPe 2.07
  
• d4ntyc_ appears in the current release, SCOPe 2.08