Class a: All alpha proteins [46456] (289 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.0: automated matches [194891] (1 protein) not a true family |
Protein automated matches [194892] (2 species) not a true protein |
Species Micrurus tener [TaxId:1114302] [237091] (3 PDB entries) |
Domain d4ntyc_: 4nty C: [237691] Other proteins in same PDB: d4ntyb_ automated match to d4ntxc_ complexed with cl, cs, pe4 |
PDB Entry: 4nty (more details), 2.65 Å
SCOPe Domain Sequences for d4ntyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ntyc_ a.133.1.0 (C:) automated matches {Micrurus tener [TaxId: 1114302]} nlnqfrlmikctndrvwadfvdygcycvardsntpvddldrccqaqkqcydeavkvhgck plvmfysfecrylasdldcsgnntkcrnfvcncdrtatlciltatynrnnhkidpsrc
Timeline for d4ntyc_: