| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.14: CBM4/9 [74893] (4 proteins) |
| Protein Cellulose-binding domain of cellulase C [49809] (1 species) |
| Species Cellulomonas fimi [TaxId:1708] [49810] (4 PDB entries) |
| Domain d1ulpa_: 1ulp A: [23769] first N-terminal CBD |
PDB Entry: 1ulp (more details)
SCOPe Domain Sequences for d1ulpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ulpa_ b.18.1.14 (A:) Cellulose-binding domain of cellulase C {Cellulomonas fimi [TaxId: 1708]}
aspigegtfddgpegwvaygtdgpldtstgalcvavpagsaqygvgvvlngvaieegtty
tlrytatastdvtvralvgqngapygtvldtspaltseprqvtetftasatypatpaadd
pegqiafqlggfsadawtlclddvaldsevel
Timeline for d1ulpa_: