Lineage for d4nrla_ (4nrl A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1305718Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1305719Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1305764Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1305765Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1306039Species Influenza b virus [TaxId:11520] [188441] (3 PDB entries)
  8. 1306041Domain d4nrla_: 4nrl A: [237685]
    automated match to d3bt6a_
    complexed with nag; mutant

Details for d4nrla_

PDB Entry: 4nrl (more details), 2.72 Å

PDB Description: Structure of hemagglutinin with F95Y mutation of influenza virus B/Lee/40
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4nrla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nrla_ b.19.1.2 (A:) Hemagglutinin {Influenza b virus}
drictgitssnsphvvktatqgevnvtgvipltttptrshfanlkgtqtrgklcpncfnc
tdldvalgrpkcmgnipsakvsilhevkpvtsgcypimhdrtkirqlpnllrgyenirls
tsnvintetapggpykvgtsgscpnvtngngffntmawvipkdnnkiainpvtvevpyic
segedqitvwgfhsddktqmerlygdsnpqkftssangvtthyvsqiggfpnqtedeglk
qsgrivvdymvqkpgktgtivyqrgillpqkvwcasgrskvikgslpligeadclhekyg
glnkskpyytgehakaigncpiwvktplklangtkyrppak

SCOPe Domain Coordinates for d4nrla_:

Click to download the PDB-style file with coordinates for d4nrla_.
(The format of our PDB-style files is described here.)

Timeline for d4nrla_: