Lineage for d4nqua1 (4nqu A:237-341)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.0: automated matches [191470] (1 protein)
not a true familyProtein automated matches [190740] (31 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) 
Domain d4nqua1: 4nqu A:237-341 [237681]
automated match to d1igtb3
complexed with so4
Details for d4nqua1
PDB Entry: 4nqu (more details), 2.5 Å
PDB Description: anti-parallel Fc-knob (T366W) homodimer
PDB Compounds: (A:) Ig gamma-1 chain C regionSCOPe Domain Sequences for d4nqua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nqua1 b.1.1.0 (A:237-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg
SCOPe Domain Coordinates for d4nqua1:
Click to download the PDB-style file with coordinates for d4nqua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4nqua1:
- d4nqua1 first appeared in SCOPe 2.03
- d4nqua1 appears in SCOPe 2.07
View in 3D
