Lineage for d1uloa_ (1ulo A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2046775Family b.18.1.14: CBM4/9 [74893] (4 proteins)
  6. 2046783Protein Cellulose-binding domain of cellulase C [49809] (1 species)
  7. 2046784Species Cellulomonas fimi [TaxId:1708] [49810] (4 PDB entries)
  8. 2046787Domain d1uloa_: 1ulo A: [23768]
    first N-terminal CBD
    CASP2

Details for d1uloa_

PDB Entry: 1ulo (more details)

PDB Description: n-terminal cellulose-binding domain from cellulomonas fimi beta-1,4- glucanase c, nmr, minimized average structure
PDB Compounds: (A:) endoglucanase c

SCOPe Domain Sequences for d1uloa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uloa_ b.18.1.14 (A:) Cellulose-binding domain of cellulase C {Cellulomonas fimi [TaxId: 1708]}
aspigegtfddgpegwvaygtdgpldtstgalcvavpagsaqygvgvvlngvaieegtty
tlrytatastdvtvralvgqngapygtvldtspaltseprqvtetftasatypatpaadd
pegqiafqlggfsadawtlclddvaldsevel

SCOPe Domain Coordinates for d1uloa_:

Click to download the PDB-style file with coordinates for d1uloa_.
(The format of our PDB-style files is described here.)

Timeline for d1uloa_: