SCOP 1.75: Domain d1uloa_: 1ulo A:

Lineage for d1uloa_ (1ulo A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families)

5. Family b.18.1.14: CBM4/9 [74893] (3 proteins)

6. Protein Cellulose-binding domain of cellulase C [49809] (1 species)

7. Species Cellulomonas fimi [TaxId:1708] [49810] (4 PDB entries)

8. Domain d1uloa_: 1ulo A: [23768]
   first N-terminal CBD
   CASP2

Details for d1uloa_

PDB Entry: 1ulo

PDB Description: n-terminal cellulose-binding domain from cellulomonas fimi beta-1,4- glucanase c, nmr, minimized average structure

PDB Compounds: (A:) endoglucanase c

SCOP Domain Sequences for d1uloa_:

Sequence; same for both SEQRES and ATOM records:

>d1uloa_ b.18.1.14 (A:) Cellulose-binding domain of cellulase C {Cellulomonas fimi [TaxId: 1708]}
aspigegtfddgpegwvaygtdgpldtstgalcvavpagsaqygvgvvlngvaieegtty
tlrytatastdvtvralvgqngapygtvldtspaltseprqvtetftasatypatpaadd
pegqiafqlggfsadawtlclddvaldsevel

Timeline for d1uloa_:

• d1uloa_ first appeared (with stable ids) in SCOP 1.55, called d1ulo__
  
• d1uloa_ appears in SCOP 1.73
  
• d1uloa_ appears in SCOPe 2.01
  
• d1uloa_ appears in the current release, SCOPe 2.08