Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
Protein N-methyl-D-aspartate receptor subunit 1 [89787] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [89788] (14 PDB entries) |
Domain d4nf6a_: 4nf6 A: [237677] automated match to d1pb7a_ complexed with 2jl, gly |
PDB Entry: 4nf6 (more details), 2.1 Å
SCOPe Domain Sequences for d4nf6a_:
Sequence, based on SEQRES records: (download)
>d4nf6a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} trlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqcc ygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmiva pltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdi yfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttge lffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryqec
>d4nf6a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} trlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpnhtvpqccygfcidll iklartmnftyevhlvadgkfgtqervnsnkkewngmmgellsgqadmivapltinnera qyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiyfrrqvels tmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgelffrsgfgi gmrkdspwkqnvslsilkshengfmedldktwvryqec
Timeline for d4nf6a_: