Lineage for d4nf4a_ (4nf4 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1879044Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)
  6. 1879706Protein N-methyl-D-aspartate receptor subunit 1 [89787] (2 species)
  7. 1879707Species Norway rat (Rattus norvegicus) [TaxId:10116] [89788] (14 PDB entries)
  8. 1879723Domain d4nf4a_: 4nf4 A: [237676]
    Other proteins in same PDB: d4nf4b_
    automated match to d1pb7a_
    complexed with 2jk, glu

Details for d4nf4a_

PDB Entry: 4nf4 (more details), 2 Å

PDB Description: crystal structure of glun1/glun2a ligand-binding domain in complex with dcka and glutamate
PDB Compounds: (A:) Glutamate receptor ionotropic, NMDA 1

SCOPe Domain Sequences for d4nf4a_:

Sequence, based on SEQRES records: (download)

>d4nf4a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
trlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqcc
ygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmiva
pltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdi
yfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttge
lffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvry

Sequence, based on observed residues (ATOM records): (download)

>d4nf4a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
trlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndgsprhtvpqccygf
cidlliklartmnftyevhlvadgkfgtqervkkewngmmgellsgqadmivapltinne
raqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiyfrrqve
lstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgelffrsgf
gigmrkdspwkqnvslsilkshengfmedldktwvry

SCOPe Domain Coordinates for d4nf4a_:

Click to download the PDB-style file with coordinates for d4nf4a_.
(The format of our PDB-style files is described here.)

Timeline for d4nf4a_: