SCOP 1.73: Domain d1bhgb2: 1bhg B:22-225

Lineage for d1bhgb2 (1bhg B:22-225)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families)

5. Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (2 proteins)

6. Protein beta-Glucuronidase [49806] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49807] (1 PDB entry)

8. Domain d1bhgb2: 1bhg B:22-225 [23767]
   Other proteins in same PDB: d1bhga1, d1bhga3, d1bhgb1, d1bhgb3
   complexed with man, nag

Details for d1bhgb2

PDB Entry: 1bhg, 2.6 Å

PDB Description: human beta-glucuronidase at 2.6 a resolution

PDB Compounds: (B:) beta-glucuronidase

SCOP Domain Sequences for d1bhgb2:

Sequence; same for both SEQRES and ATOM records:

>d1bhgb2 b.18.1.5 (B:22-225) beta-Glucuronidase {Human (Homo sapiens) [TaxId: 9606]}
glqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvps
sfndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtle
heggylpfeadisnlvqvgplpsrlritiainntltpttlppgtiqyltdtskypkgyfv
qntyfdffnyaglqrsvllyttpt

Timeline for d1bhgb2:

• d1bhgb2 first appeared (with stable ids) in SCOP 1.55
  
• d1bhgb2 appears in SCOP 1.71
  
• d1bhgb2 appears in SCOP 1.75
  
• d1bhgb2 appears in the current release, SCOPe 2.08