Class b: All beta proteins [48724] (119 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (15 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (2 proteins) |
Protein beta-Glucuronidase [49806] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49807] (1 PDB entry) |
Domain d1bhgb2: 1bhg B:22-225 [23767] Other proteins in same PDB: d1bhga1, d1bhga3, d1bhgb1, d1bhgb3 complexed with man, nag |
PDB Entry: 1bhg (more details), 2.6 Å
SCOP Domain Sequences for d1bhgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bhgb2 b.18.1.5 (B:22-225) beta-Glucuronidase {Human (Homo sapiens)} glqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvps sfndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtle heggylpfeadisnlvqvgplpsrlritiainntltpttlppgtiqyltdtskypkgyfv qntyfdffnyaglqrsvllyttpt
Timeline for d1bhgb2: