Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.15: EutN/CcmL-like [159133] (2 families) homohexameric unit |
Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins) Pfam PF03319 |
Protein Carbon dioxide concentrating mechanism protein CcmL [159139] (3 species) |
Species Thermosynechococcus elongatus [TaxId:197221] [227737] (2 PDB entries) |
Domain d4n8fb_: 4n8f B: [237667] automated match to d4jvzd_ complexed with mg, so4 |
PDB Entry: 4n8f (more details), 2 Å
SCOPe Domain Sequences for d4n8fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n8fb_ b.40.15.1 (B:) Carbon dioxide concentrating mechanism protein CcmL {Thermosynechococcus elongatus [TaxId: 197221]} mkiarvcgtvtstqkedtltgvkflvlqylgedgeflpdyevaadtvgagqdewvlvsrg saarhiingtdkpidaavvaiidtvsrdnyllysk
Timeline for d4n8fb_:
View in 3D Domains from other chains: (mouse over for more information) d4n8fa_, d4n8fc_, d4n8fd_, d4n8fe_ |