Lineage for d4n8fb_ (4n8f B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2791232Superfamily b.40.15: EutN/CcmL-like [159133] (2 families) (S)
    homohexameric unit
  5. 2791233Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins)
    Pfam PF03319
  6. 2791234Protein Carbon dioxide concentrating mechanism protein CcmL [159139] (3 species)
  7. 2791277Species Thermosynechococcus elongatus [TaxId:197221] [227737] (2 PDB entries)
  8. 2791279Domain d4n8fb_: 4n8f B: [237667]
    automated match to d4jvzd_
    complexed with mg, so4

Details for d4n8fb_

PDB Entry: 4n8f (more details), 2 Å

PDB Description: CcmL from Thermosynechococcus elongatus BP-1
PDB Compounds: (B:) Carbon dioxide concentrating mechanism protein

SCOPe Domain Sequences for d4n8fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n8fb_ b.40.15.1 (B:) Carbon dioxide concentrating mechanism protein CcmL {Thermosynechococcus elongatus [TaxId: 197221]}
mkiarvcgtvtstqkedtltgvkflvlqylgedgeflpdyevaadtvgagqdewvlvsrg
saarhiingtdkpidaavvaiidtvsrdnyllysk

SCOPe Domain Coordinates for d4n8fb_:

Click to download the PDB-style file with coordinates for d4n8fb_.
(The format of our PDB-style files is described here.)

Timeline for d4n8fb_: