![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.15: EutN/CcmL-like [159133] (1 family) ![]() homohexameric unit |
![]() | Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins) Pfam PF03319 |
![]() | Protein Carbon dioxide concentrating mechanism protein CcmL [159139] (3 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [227737] (2 PDB entries) |
![]() | Domain d4n8fa_: 4n8f A: [237666] automated match to d4jvzd_ complexed with mg, so4 |
PDB Entry: 4n8f (more details), 2 Å
SCOPe Domain Sequences for d4n8fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n8fa_ b.40.15.1 (A:) Carbon dioxide concentrating mechanism protein CcmL {Thermosynechococcus elongatus [TaxId: 197221]} mkiarvcgtvtstqkedtltgvkflvlqylgedgeflpdyevaadtvgagqdewvlvsrg saarhiingtdkpidaavvaiidtvsrdnyllysk
Timeline for d4n8fa_: