Lineage for d1bhga2 (1bhg A:22-225)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1116326Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1116327Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1116431Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 1116573Protein beta-Glucuronidase [49806] (1 species)
  7. 1116574Species Human (Homo sapiens) [TaxId:9606] [49807] (1 PDB entry)
  8. 1116575Domain d1bhga2: 1bhg A:22-225 [23766]
    Other proteins in same PDB: d1bhga1, d1bhga3, d1bhgb1, d1bhgb3

Details for d1bhga2

PDB Entry: 1bhg (more details), 2.53 Å

PDB Description: human beta-glucuronidase at 2.6 a resolution
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d1bhga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhga2 b.18.1.5 (A:22-225) beta-Glucuronidase {Human (Homo sapiens) [TaxId: 9606]}
glqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvps
sfndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtle
heggylpfeadisnlvqvgplpsrlritiainntltpttlppgtiqyltdtskypkgyfv
qntyfdffnyaglqrsvllyttpt

SCOPe Domain Coordinates for d1bhga2:

Click to download the PDB-style file with coordinates for d1bhga2.
(The format of our PDB-style files is described here.)

Timeline for d1bhga2: