Lineage for d4m5xb_ (4m5x B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155259Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 protein domains)
    Pfam PF00443
  6. 2155284Protein automated matches [191167] (1 species)
    not a true protein
  7. 2155285Species Human (Homo sapiens) [TaxId:9606] [189384] (14 PDB entries)
  8. 2155290Domain d4m5xb_: 4m5x B: [237645]
    automated match to d1nb8b_
    complexed with br

Details for d4m5xb_

PDB Entry: 4m5x (more details), 2.19 Å

PDB Description: crystal structure of the usp7/hausp catalytic domain
PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase 7

SCOPe Domain Sequences for d4m5xb_:

Sequence, based on SEQRES records: (download)

>d4m5xb_ d.3.1.9 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel
qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk
mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq
eaekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpan
yilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlsv
rhctnaymlvyiresklsevlqavtdhdipqqlverlqeekrieaqk

Sequence, based on observed residues (ATOM records): (download)

>d4m5xb_ d.3.1.9 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel
qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk
mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq
eaekgvkfltlppvlhlqlmrfmyddqnikindrfefpeqlpldeflqktdpkdpanyil
havlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghhctnaymlv
yiresklsevlqavtdhdipqqlverlqeekrieaqk

SCOPe Domain Coordinates for d4m5xb_:

Click to download the PDB-style file with coordinates for d4m5xb_.
(The format of our PDB-style files is described here.)

Timeline for d4m5xb_: