SCOPe 2.05: Domain d4l2la3: 4l2l A:461-610

Lineage for d4l2la3 (4l2l A:461-610)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein)
   automatically mapped to Pfam PF09127
   this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain

6. Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63610] (45 PDB entries)
   Uniprot P09960

8. Domain d4l2la3: 4l2l A:461-610 [237642]
   Other proteins in same PDB: d4l2la1, d4l2la2
   automated match to d2vj8a1
   complexed with 1v6, act, yb, zn

Details for d4l2la3

PDB Entry: 4l2l, 1.65 Å

PDB Description: human leukotriene a4 hydrolase complexed with ligand 4-(4- benzylphenyl)thiazol-2-amine

PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d4l2la3:

Sequence; same for both SEQRES and ATOM records:

>d4l2la3 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkvd

Timeline for d4l2la3:

• d4l2la3 first appeared in SCOPe 2.03
  
• d4l2la3 appears in SCOPe 2.04
  
• d4l2la3 appears in SCOPe 2.06
  
• d4l2la3 appears in the current release, SCOPe 2.08