Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
Protein automated matches [190116] (24 species) not a true protein |
Species Acidaminococcus fermentans [TaxId:591001] [236033] (2 PDB entries) |
Domain d4l2ib_: 4l2i B: [237638] automated match to d4kpub_ complexed with cl, fad, nad |
PDB Entry: 4l2i (more details), 1.45 Å
SCOPe Domain Sequences for d4l2ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l2ib_ c.26.2.0 (B:) automated matches {Acidaminococcus fermentans [TaxId: 591001]} mnivvcvkqvpdtaemkidpvtnnlvrdgvtnimnpydqyaletalqlkdelgahvtvit mgpphaesvlrdclavgadeaklvsdrafggadtlatsaamantikhfgvpdlilcgrqa idgdtaqvgpeiaehlglpqvtaalkvqvkddtvvvdrdneqmsmtftmkmpcvvtvmrs kdlrfasirgkmkarkaeipvytaaaleipldiigkagsptqvmksftpkvtqvhgeifd dedpavavdklvnkliedkiitk
Timeline for d4l2ib_: