Lineage for d4kqka_ (4kqk A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1850505Fold c.39: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52732] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567
  4. 1850506Superfamily c.39.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52733] (2 families) (S)
  5. 1850507Family c.39.1.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52734] (2 proteins)
    automatically mapped to Pfam PF02277
  6. 1850540Protein automated matches [190818] (2 species)
    not a true protein
  7. 1850541Species Salmonella enterica [TaxId:99287] [237634] (6 PDB entries)
  8. 1850543Domain d4kqka_: 4kqk A: [237635]
    automated match to d1jh8a_
    complexed with edo, gol, pcr, so4

Details for d4kqka_

PDB Entry: 4kqk (more details), 1.47 Å

PDB Description: Crystal structure of CobT S80Y/Q88M/L175M complexed with p-cresol
PDB Compounds: (A:) Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase

SCOPe Domain Sequences for d4kqka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kqka_ c.39.1.1 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
tlhallrdipapdaeamaraqqhidgllkppgslgrletlavqlagmpglngtpqvgeka
vlvmcadhgvwdegvavypkivtaimaanmtrgttgvcvlaaqagakvhvidvgidaepi
pgvvnmrvargcgniavgpamsrlqaealllevsrytcdlaqrgvtlfgvgemgmanttp
aaamvsvftgsdakevvgiganlppsridnkvdvvrraiainqpnprdgidvlskvggfd
lvgmtgvmlgaarcglpvlldgflsysaalaacqiapavrpylipshfsaekgarialah
lsmepylhmamrlgegsgaalampiveaacamfhnmgelaasnivlp

SCOPe Domain Coordinates for d4kqka_:

Click to download the PDB-style file with coordinates for d4kqka_.
(The format of our PDB-style files is described here.)

Timeline for d4kqka_: