SCOPe 2.05: Domain d4khxl1: 4khx L:2-109

Lineage for d4khxl1 (4khx L:2-109)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d4khxl1: 4khx L:2-109 [237630]
   automated match to d3ma9l1

Details for d4khxl1

PDB Entry: 4khx, 2.92 Å

PDB Description: crystal structure of gp41 helix complexed with antibody 8062

PDB Compounds: (L:) 8062 light chain

SCOPe Domain Sequences for d4khxl1:

Sequence; same for both SEQRES and ATOM records:

>d4khxl1 b.1.1.0 (L:2-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ieltqppsvsvvpgqtariscsgdnipyeyaswyqqkpgqapvlviygdnnrpsgiperf
sgsnsgntatltisgtqaedeadyycaswdsmtvdgvfgggtkltvlg

Timeline for d4khxl1:

• d4khxl1 first appeared in SCOPe 2.03
  
• d4khxl1 appears in SCOPe 2.04
  
• d4khxl1 appears in SCOPe 2.06
  
• d4khxl1 appears in the current release, SCOPe 2.08