Lineage for d4kb4a_ (4kb4 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956973Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2957018Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) (S)
    automatically mapped to Pfam PF01765
  5. 2957052Family d.67.3.0: automated matches [227278] (1 protein)
    not a true family
  6. 2957053Protein automated matches [227087] (4 species)
    not a true protein
  7. 2957062Species Mycobacterium tuberculosis [TaxId:1773] [237624] (4 PDB entries)
  8. 2957063Domain d4kb4a_: 4kb4 A: [237627]
    automated match to d1is1a_
    complexed with cd; mutant

Details for d4kb4a_

PDB Entry: 4kb4 (more details), 2.25 Å

PDB Description: crystal structure of ribosome recycling factor mutant r31a from mycobacterium tuberculosis
PDB Compounds: (A:) Ribosome-recycling factor

SCOPe Domain Sequences for d4kb4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kb4a_ d.67.3.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
idealfdaeekmekavavarddlstirtgaanpgmfsritidyygaatpitqlasinvpe
arlvvikpyeanqlraietairnsdlgvnptndgalirvavpqlteerrrelvkqakhkg
eeakvsvrnirrkameelhrirkegeagedevgraekdldktthqyvtqidelvkhkege
llev

SCOPe Domain Coordinates for d4kb4a_:

Click to download the PDB-style file with coordinates for d4kb4a_.
(The format of our PDB-style files is described here.)

Timeline for d4kb4a_: