| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies) core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) ![]() automatically mapped to Pfam PF01765 |
| Family d.67.3.0: automated matches [227278] (1 protein) not a true family |
| Protein automated matches [227087] (4 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [237624] (4 PDB entries) |
| Domain d4kb4a_: 4kb4 A: [237627] automated match to d1is1a_ complexed with cd; mutant |
PDB Entry: 4kb4 (more details), 2.25 Å
SCOPe Domain Sequences for d4kb4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kb4a_ d.67.3.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
idealfdaeekmekavavarddlstirtgaanpgmfsritidyygaatpitqlasinvpe
arlvvikpyeanqlraietairnsdlgvnptndgalirvavpqlteerrrelvkqakhkg
eeakvsvrnirrkameelhrirkegeagedevgraekdldktthqyvtqidelvkhkege
llev
Timeline for d4kb4a_: