![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies) core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
![]() | Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) ![]() automatically mapped to Pfam PF01765 |
![]() | Family d.67.3.0: automated matches [227278] (1 protein) not a true family |
![]() | Protein automated matches [227087] (4 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [237624] (4 PDB entries) |
![]() | Domain d4kc6a_: 4kc6 A: [237626] automated match to d1is1a_ complexed with cd; mutant |
PDB Entry: 4kc6 (more details), 2.4 Å
SCOPe Domain Sequences for d4kc6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kc6a_ d.67.3.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} idealfdaeekmekavavarddlstirtgranpgmfsritidyygaatpitqlasinvpe arlvvikpyeanqlraietairnsdlgvnptndgalirvavpqlteerrrelvkqakhkg eeakvsvrnirrkameelhrirkegeagedevgraekdldktthqyvtqidelvkhke
Timeline for d4kc6a_: