SCOPe 2.08: Domain d4j4pd2: 4j4p D:131-233

Lineage for d4j4pd2 (4j4p D:131-233)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4j4pd2: 4j4p D:131-233 [237620]
   Other proteins in same PDB: d4j4pa1, d4j4pa2, d4j4pa3, d4j4pb1, d4j4pb2, d4j4pb3, d4j4pd1, d4j4pl1
   automated match to d2fb4l2

Details for d4j4pd2

PDB Entry: 4j4p, 2.91 Å

PDB Description: the complex of human ige-fc with two bound fab fragments

PDB Compounds: (D:) Immunoglobulin G Fab Fragment Light Chain

SCOPe Domain Sequences for d4j4pd2:

Sequence; same for both SEQRES and ATOM records:

>d4j4pd2 b.1.1.2 (D:131-233) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

Timeline for d4j4pd2:

• d4j4pd2 first appeared in SCOPe 2.03
  
• d4j4pd2 appears in SCOPe 2.07