Lineage for d1f4ha3 (1f4h A:3-219)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 163940Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 163941Superfamily b.18.1: Galactose-binding domain-like [49785] (15 families) (S)
  5. 163983Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (2 proteins)
  6. 163984Protein beta-Galactosidase [49804] (1 species)
  7. 163985Species Escherichia coli [TaxId:562] [49805] (23 PDB entries)
  8. 164086Domain d1f4ha3: 1f4h A:3-219 [23762]
    Other proteins in same PDB: d1f4ha1, d1f4ha2, d1f4ha4, d1f4ha5, d1f4hb1, d1f4hb2, d1f4hb4, d1f4hb5, d1f4hc1, d1f4hc2, d1f4hc4, d1f4hc5, d1f4hd1, d1f4hd2, d1f4hd4, d1f4hd5

Details for d1f4ha3

PDB Entry: 1f4h (more details), 2.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (orthorhombic)

SCOP Domain Sequences for d1f4ha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4ha3 b.18.1.5 (A:3-219) beta-Galactosidase {Escherichia coli}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOP Domain Coordinates for d1f4ha3:

Click to download the PDB-style file with coordinates for d1f4ha3.
(The format of our PDB-style files is described here.)

Timeline for d1f4ha3: