| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
| Protein beta-Galactosidase [49804] (3 species) |
| Species Escherichia coli [TaxId:562] [49805] (46 PDB entries) Uniprot P00722 |
| Domain d1f4ha3: 1f4h A:3-219 [23762] Other proteins in same PDB: d1f4ha1, d1f4ha2, d1f4ha4, d1f4ha5, d1f4hb1, d1f4hb2, d1f4hb4, d1f4hb5, d1f4hc1, d1f4hc2, d1f4hc4, d1f4hc5, d1f4hd1, d1f4hd2, d1f4hd4, d1f4hd5 complexed with mg |
PDB Entry: 1f4h (more details), 2.8 Å
SCOPe Domain Sequences for d1f4ha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4ha3 b.18.1.5 (A:3-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d1f4ha3:
View in 3DDomains from same chain: (mouse over for more information) d1f4ha1, d1f4ha2, d1f4ha4, d1f4ha5 |