Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d4j4pl2: 4j4p L:131-233 [237618] Other proteins in same PDB: d4j4pa1, d4j4pa2, d4j4pa3, d4j4pb1, d4j4pb2, d4j4pb3, d4j4pd1, d4j4pl1 automated match to d2fb4l2 |
PDB Entry: 4j4p (more details), 2.91 Å
SCOPe Domain Sequences for d4j4pl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j4pl2 b.1.1.2 (L:131-233) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvapte
Timeline for d4j4pl2: