Lineage for d4j4pl2 (4j4p L:131-233)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751773Domain d4j4pl2: 4j4p L:131-233 [237618]
    Other proteins in same PDB: d4j4pa1, d4j4pa2, d4j4pa3, d4j4pb1, d4j4pb2, d4j4pb3, d4j4pd1, d4j4pl1
    automated match to d2fb4l2

Details for d4j4pl2

PDB Entry: 4j4p (more details), 2.91 Å

PDB Description: the complex of human ige-fc with two bound fab fragments
PDB Compounds: (L:) Immunoglobulin G Fab Fragment Light Chain

SCOPe Domain Sequences for d4j4pl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j4pl2 b.1.1.2 (L:131-233) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

SCOPe Domain Coordinates for d4j4pl2:

Click to download the PDB-style file with coordinates for d4j4pl2.
(The format of our PDB-style files is described here.)

Timeline for d4j4pl2: