SCOPe 2.08: Domain d4j4pl1: 4j4p L:19-130

Lineage for d4j4pl1 (4j4p L:19-130)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4j4pl1: 4j4p L:19-130 [237617]
   Other proteins in same PDB: d4j4pd2, d4j4pl2
   automated match to d2mcg11

Details for d4j4pl1

PDB Entry: 4j4p, 2.91 Å

PDB Description: the complex of human ige-fc with two bound fab fragments

PDB Compounds: (L:) Immunoglobulin G Fab Fragment Light Chain

SCOPe Domain Sequences for d4j4pl1:

Sequence; same for both SEQRES and ATOM records:

>d4j4pl1 b.1.1.0 (L:19-130) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqsvltqppsasgtpgqrvtiscsgsssnignngvnwyqqvpgkppklliyyddllpsgv
sdrfsgsksgtsaslaisglqsedeadyyceawddsldgvvfgggtkltvlg

Timeline for d4j4pl1:

• d4j4pl1 first appeared in SCOPe 2.03
  
• d4j4pl1 appears in SCOPe 2.07